Recombinant Full Length Human BTN3A1 Protein, C-Flag-tagged
Cat.No. : | BTN3A1-1530HFL |
Product Overview : | Recombinant Full Length Human BTN3A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene and the BTN2 and genes, which have undergone tandem duplication, resulting in 3 copies of each. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.5 kDa |
AA Sequence : | MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKTPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF SEALYPVFRILTLEPTALTICPATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | BTN3A1 butyrophilin subfamily 3 member A1 [ Homo sapiens (human) ] |
Official Symbol | BTN3A1 |
Synonyms | BTF5; BT3.1; CD277; BTN3.1 |
Gene ID | 11119 |
mRNA Refseq | NM_007048.6 |
Protein Refseq | NP_008979.3 |
MIM | 613593 |
UniProt ID | O00481 |
◆ Recombinant Proteins | ||
BTN3A1-331H | Recombinant Human BTN3A1 Protein, His-tagged | +Inquiry |
BTN3A1-013H | Recombinant Human BTN3A1 Protein, His-tagged | +Inquiry |
BTN3A1-0798H | Recombinant Human BTN3A1 Protein (Gln30-Gly254), C-Fc tagged | +Inquiry |
BTN3A1-47H | Recombinant Human BTN3A1 protein, His-tagged | +Inquiry |
BTN3A1-1658R | Recombinant Rhesus Monkey BTN3A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A1-8386HCL | Recombinant Human BTN3A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTN3A1 Products
Required fields are marked with *
My Review for All BTN3A1 Products
Required fields are marked with *
0
Inquiry Basket