Recombinant Full Length Human BTN3A1 Protein, C-Flag-tagged

Cat.No. : BTN3A1-1530HFL
Product Overview : Recombinant Full Length Human BTN3A1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin (Ig) domains and an intracellular B30.2 (PRYSPRY) domain. Three subfamilies of human BTN genes are located in the MHC class I region: the single-copy BTN1A1 gene and the BTN2 and genes, which have undergone tandem duplication, resulting in 3 copies of each.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 57.5 kDa
AA Sequence : MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKTPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF
SEALYPVFRILTLEPTALTICPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Full Length : Full L.
Gene Name BTN3A1 butyrophilin subfamily 3 member A1 [ Homo sapiens (human) ]
Official Symbol BTN3A1
Synonyms BTF5; BT3.1; CD277; BTN3.1
Gene ID 11119
mRNA Refseq NM_007048.6
Protein Refseq NP_008979.3
MIM 613593
UniProt ID O00481

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTN3A1 Products

Required fields are marked with *

My Review for All BTN3A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon