Recombinant Full Length Human BTN3A2 Protein, C-Flag-tagged
Cat.No. : | BTN3A2-380HFL |
Product Overview : | Recombinant Full Length Human BTN3A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the immunoglobulin superfamily, which resides in the juxta-telomeric region of the major histocompatability class 1 locus and is clustered with the other family members on chromosome 6. The encoded protein may be involved in the adaptive immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.2 kDa |
AA Sequence : | MKMASSLAFLLLNFHVSLLLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE LKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIM RGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPILLLLLAGASYFLWRQQKEITAL SSEIESEQEMKEMGYAATEREISLRESLQEELKRKKIQYLTRGEESSSDTNKSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | BTN3A2 butyrophilin subfamily 3 member A2 [ Homo sapiens (human) ] |
Official Symbol | BTN3A2 |
Synonyms | BTF4; BT3.2; CD277; BTN3.2 |
Gene ID | 11118 |
mRNA Refseq | NM_007047.5 |
Protein Refseq | NP_008978.2 |
MIM | 613594 |
UniProt ID | P78410 |
◆ Recombinant Proteins | ||
BTN3A2-395H | Recombinant Human BTN3A2 Protein, GST-tagged | +Inquiry |
BTN3A2-364H | Recombinant Human BTN3A2 Protein (30-248 aa), His-SUMO-tagged | +Inquiry |
BTN3A2-457H | Recombinant Human BTN3A2 Protein, His-tagged | +Inquiry |
BTN3A2-1739H | Recombinant Human BTN3A2 Protein (30-248 aa), His-tagged | +Inquiry |
BTN3A2-380HFL | Recombinant Full Length Human BTN3A2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A2-8385HCL | Recombinant Human BTN3A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTN3A2 Products
Required fields are marked with *
My Review for All BTN3A2 Products
Required fields are marked with *
0
Inquiry Basket