Recombinant Human BTN3A2 Protein (30-248 aa), His-SUMO-tagged
Cat.No. : | BTN3A2-364H |
Product Overview : | Recombinant Human BTN3A2 Protein (30-248 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 30-248 aa |
Description : | Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 39.6 kDa |
AA Sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | BTN3A2 butyrophilin, subfamily 3, member A2 [ Homo sapiens ] |
Official Symbol | BTN3A2 |
Synonyms | BTN3A2; BTF4; BT3.2; BT3.3; FLJ40011; |
Gene ID | 11118 |
mRNA Refseq | NM_001197246 |
Protein Refseq | NP_001184175 |
MIM | 613594 |
UniProt ID | P78410 |
◆ Recombinant Proteins | ||
BTN3A2-0796H | Recombinant Human BTN3A2 Protein (Gln30-Trp248), C-His tagged | +Inquiry |
BTN3A2-1677HF | Recombinant Full Length Human BTN3A2 Protein, GST-tagged | +Inquiry |
BTN3A2-051H | Active Recombinant Human BTN3A2 protein, His/Avi-tagged, Biotinylated | +Inquiry |
BTN3A2-458H | Recombinant Human BTN3A2 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
BTN3A2-6613H | Recombinant Human BTN3A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTN3A2-8385HCL | Recombinant Human BTN3A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTN3A2 Products
Required fields are marked with *
My Review for All BTN3A2 Products
Required fields are marked with *
0
Inquiry Basket