Recombinant Human BTN3A2 Protein (30-248 aa), His-SUMO-tagged
| Cat.No. : | BTN3A2-364H |
| Product Overview : | Recombinant Human BTN3A2 Protein (30-248 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 30-248 aa |
| Description : | Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | BTN3A2 butyrophilin, subfamily 3, member A2 [ Homo sapiens ] |
| Official Symbol | BTN3A2 |
| Synonyms | BTN3A2; BTF4; BT3.2; BT3.3; FLJ40011; |
| Gene ID | 11118 |
| mRNA Refseq | NM_001197246 |
| Protein Refseq | NP_001184175 |
| MIM | 613594 |
| UniProt ID | P78410 |
| ◆ Recombinant Proteins | ||
| BTN3A2-051H | Active Recombinant Human BTN3A2 protein, His/Avi-tagged, Biotinylated | +Inquiry |
| BTN3A2-458H | Recombinant Human BTN3A2 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
| BTN3A2-364H | Recombinant Human BTN3A2 Protein (30-248 aa), His-SUMO-tagged | +Inquiry |
| BTN3A2-6613H | Recombinant Human BTN3A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BTN3A2-457H | Recombinant Human BTN3A2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTN3A2-8385HCL | Recombinant Human BTN3A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTN3A2 Products
Required fields are marked with *
My Review for All BTN3A2 Products
Required fields are marked with *
