Recombinant Human BTN3A2 Protein (30-248 aa), His-SUMO-tagged

• Cat.No.: BTN3A2-364H
• Product Overview: Recombinant Human BTN3A2 Protein (30-248 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 30-248 aa
• Description: Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 39.6 kDa
• AA Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: BTN3A2 butyrophilin, subfamily 3, member A2 [ Homo sapiens ]
• Official Symbol: BTN3A2
• Synonyms: BTN3A2; BTF4; BT3.2; BT3.3; FLJ40011
• Gene ID: 11118
• mRNA Refseq: NM_001197246
• Protein Refseq: NP_001184175
• MIM: 613594
• UniProt ID: P78410