Recombinant Full Length Human C11orf86 Protein, GST-tagged

Cat.No. : C11orf86-1985HF
Product Overview : Human C11orf86 full-length ORF (1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 143 amino acids
Description : C11orf86 (Chromosome 11 Open Reading Frame 86) is a Protein Coding gene.
Molecular Mass : 42.13 kDa
AA Sequence : MGGGTGPPQRASVLLRGRSSPVPAASGAMGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLGDTEQLIQAQRRGSRWWLRRYQQVRRRWESFVAIFPSVTLSQPASP
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C11orf86 chromosome 11 open reading frame 86 [ Homo sapiens ]
Official Symbol C11orf86
Synonyms C11orf86
Gene ID 254439
mRNA Refseq NM_001136485.1
Protein Refseq NP_001129957.1
UniProt ID A6NJI1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf86 Products

Required fields are marked with *

My Review for All C11orf86 Products

Required fields are marked with *

0
cart-icon
0
compare icon