Recombinant Human C11orf86 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C11orf86-5755H
Product Overview : C11orf86 MS Standard C13 and N15-labeled recombinant protein (NP_001129957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : C11orf86 (Chromosome 11 Open Reading Frame 86) is a Protein Coding gene.
Molecular Mass : 13 kDa
AA Sequence : MGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLGDTEQLIQAQRRGSRWWLRRYQQVRRRWESFVAIFPSVTLSQPASPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C11orf86 chromosome 11 open reading frame 86 [ Homo sapiens (human) ]
Official Symbol C11orf86
Synonyms C11orf86; chromosome 11 open reading frame 86; uncharacterized protein C11orf86;
Gene ID 254439
mRNA Refseq NM_001136485
Protein Refseq NP_001129957
UniProt ID A6NJI1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C11orf86 Products

Required fields are marked with *

My Review for All C11orf86 Products

Required fields are marked with *

0
cart-icon