Recombinant Human C11orf86 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | C11orf86-5755H |
| Product Overview : | C11orf86 MS Standard C13 and N15-labeled recombinant protein (NP_001129957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | C11orf86 (Chromosome 11 Open Reading Frame 86) is a Protein Coding gene. |
| Molecular Mass : | 13 kDa |
| AA Sequence : | MGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLGDTEQLIQAQRRGSRWWLRRYQQVRRRWESFVAIFPSVTLSQPASPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | C11orf86 chromosome 11 open reading frame 86 [ Homo sapiens (human) ] |
| Official Symbol | C11orf86 |
| Synonyms | C11orf86; chromosome 11 open reading frame 86; uncharacterized protein C11orf86; |
| Gene ID | 254439 |
| mRNA Refseq | NM_001136485 |
| Protein Refseq | NP_001129957 |
| UniProt ID | A6NJI1 |
| ◆ Recombinant Proteins | ||
| C11orf86-1284H | Recombinant Human C11orf86 Protein, MYC/DDK-tagged | +Inquiry |
| C11orf86-5755H | Recombinant Human C11orf86 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| C11orf86-490H | Recombinant Human C11orf86 Protein, GST-tagged | +Inquiry |
| C11orf86-1985HF | Recombinant Full Length Human C11orf86 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf86 Products
Required fields are marked with *
My Review for All C11orf86 Products
Required fields are marked with *
