Recombinant Human C11orf86 Protein, GST-tagged

• Cat.No.: C11orf86-490H
• Product Overview: Human C11orf86 full-length ORF (1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 42.13 kDa
• AA Sequence: MGGGTGPPQRASVLLRGRSSPVPAASGAMGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLGDTEQLIQAQRRGSRWWLRRYQQVRRRWESFVAIFPSVTLSQPASP
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C11orf86 chromosome 11 open reading frame 86 [ Homo sapiens ]
• Official Symbol: C11orf86
• Synonyms: C11orf86
• Gene ID: 254439
• mRNA Refseq: NM_001136485.1
• Protein Refseq: NP_001129957.1
• UniProt ID: A6NJI1