Recombinant Human C11orf86 Protein, GST-tagged
Cat.No. : | C11orf86-490H |
Product Overview : | Human C11orf86 full-length ORF (1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 42.13 kDa |
AA Sequence : | MGGGTGPPQRASVLLRGRSSPVPAASGAMGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLGDTEQLIQAQRRGSRWWLRRYQQVRRRWESFVAIFPSVTLSQPASP |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C11orf86 chromosome 11 open reading frame 86 [ Homo sapiens ] |
Official Symbol | C11orf86 |
Synonyms | C11orf86 |
Gene ID | 254439 |
mRNA Refseq | NM_001136485.1 |
Protein Refseq | NP_001129957.1 |
UniProt ID | A6NJI1 |
◆ Recombinant Proteins | ||
C11orf86-1284H | Recombinant Human C11orf86 Protein, MYC/DDK-tagged | +Inquiry |
C11orf86-490H | Recombinant Human C11orf86 Protein, GST-tagged | +Inquiry |
C11orf86-1985HF | Recombinant Full Length Human C11orf86 Protein, GST-tagged | +Inquiry |
C11orf86-5755H | Recombinant Human C11orf86 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C11orf86 Products
Required fields are marked with *
My Review for All C11orf86 Products
Required fields are marked with *