Recombinant Full Length Human C12orf57 Protein, GST-tagged
| Cat.No. : | C12orf57-5592HF | 
| Product Overview : | Human GRCC10 full-length ORF ( AAH09925, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 126 amino acids | 
| Description : | This gene is ubiquitously expressed in human tissues. It is required for development of the human corpus callosum. Mutations in this gene are associated with Temtamy syndrome (TEMTYS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014] | 
| Molecular Mass : | 39.6 kDa | 
| AA Sequence : | MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | C12orf57 chromosome 12 open reading frame 57 [ Homo sapiens (human) ] | 
| Official Symbol | C12orf57 | 
| Synonyms | C12orf57; chromosome 12 open reading frame 57; C10; GRCC10; protein C10; gene rich cluster C10; likely ortholog of mouse gene rich cluster, C10 | 
| Gene ID | 113246 | 
| mRNA Refseq | NM_001301834 | 
| Protein Refseq | NP_001288763 | 
| MIM | 615140 | 
| UniProt ID | Q99622 | 
| ◆ Recombinant Proteins | ||
| C12orf57-5592HF | Recombinant Full Length Human C12orf57 Protein, GST-tagged | +Inquiry | 
| C12orf57-1242H | Recombinant Human C12orf57 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| C12orf57-5318H | Recombinant Human C12orf57 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C12orf57-8313HCL | Recombinant Human C12orf57 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All C12orf57 Products
Required fields are marked with *
My Review for All C12orf57 Products
Required fields are marked with *
  
        
    
      
            