Recombinant Full Length Human C19orf73 Protein, GST-tagged

Cat.No. : C19orf73-4839HF
Product Overview : Human FLJ10490 full-length ORF (BAA91643.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 129 amino acids
Description : C19orf73 (Chromosome 19 Open Reading Frame 73) is a Protein Coding gene.
Molecular Mass : 40.1 kDa
AA Sequence : MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGGVVLSSAPALRPRLGPCLRPPPSD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C19orf73 chromosome 19 open reading frame 73 [ Homo sapiens (human) ]
Official Symbol C19orf73
Synonyms C19orf73; chromosome 19 open reading frame 73; putative uncharacterized protein C19orf73
Gene ID 55150
mRNA Refseq NM_018111
Protein Refseq NP_060581
UniProt ID Q9NVV2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C19orf73 Products

Required fields are marked with *

My Review for All C19orf73 Products

Required fields are marked with *

0
cart-icon
0
compare icon