Recombinant Full Length Human C19orf73 Protein, GST-tagged
Cat.No. : | C19orf73-4839HF |
Product Overview : | Human FLJ10490 full-length ORF (BAA91643.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 129 amino acids |
Description : | C19orf73 (Chromosome 19 Open Reading Frame 73) is a Protein Coding gene. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGGVVLSSAPALRPRLGPCLRPPPSD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C19orf73 chromosome 19 open reading frame 73 [ Homo sapiens (human) ] |
Official Symbol | C19orf73 |
Synonyms | C19orf73; chromosome 19 open reading frame 73; putative uncharacterized protein C19orf73 |
Gene ID | 55150 |
mRNA Refseq | NM_018111 |
Protein Refseq | NP_060581 |
UniProt ID | Q9NVV2 |
◆ Recombinant Proteins | ||
C19orf73-4217H | Recombinant Human C19orf73 Protein, GST-tagged | +Inquiry |
C19orf73-4839HF | Recombinant Full Length Human C19orf73 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C19orf73-8195HCL | Recombinant Human C19orf73 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C19orf73 Products
Required fields are marked with *
My Review for All C19orf73 Products
Required fields are marked with *