Recombinant Full Length Human C1QL2 Protein, C-Flag-tagged
| Cat.No. : | C1QL2-1284HFL |
| Product Overview : | Recombinant Full Length Human C1QL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable identical protein binding activity. Predicted to be located in extracellular region. Predicted to be part of protein-containing complex. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 29.3 kDa |
| AA Sequence : | MALGLLIAVPLLLQAAPRGAAHYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPP PPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTAGTASGVGVVGGGAGVGG DSEGEVTSALSATFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHIL MRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFS GFLLYPDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | C1QL2 complement C1q like 2 [ Homo sapiens (human) ] |
| Official Symbol | C1QL2 |
| Synonyms | CTRP10; C1QTNF10 |
| Gene ID | 165257 |
| mRNA Refseq | NM_182528.4 |
| Protein Refseq | NP_872334.2 |
| MIM | 614330 |
| UniProt ID | Q7Z5L3 |
| ◆ Recombinant Proteins | ||
| C1QL2-466H | Recombinant Human C1QL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| C1QL2-1135M | Recombinant Mouse C1QL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| C1QL2-1284HFL | Recombinant Full Length Human C1QL2 Protein, C-Flag-tagged | +Inquiry |
| C1ql2-1908M | Recombinant Mouse C1ql2 Protein, Myc/DDK-tagged | +Inquiry |
| C1QL2-2565M | Recombinant Mouse C1QL2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QL2 Products
Required fields are marked with *
My Review for All C1QL2 Products
Required fields are marked with *



