Recombinant Full Length Human C1QL2 Protein, C-Flag-tagged
Cat.No. : | C1QL2-1284HFL |
Product Overview : | Recombinant Full Length Human C1QL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable identical protein binding activity. Predicted to be located in extracellular region. Predicted to be part of protein-containing complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | MALGLLIAVPLLLQAAPRGAAHYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPP PPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTAGTASGVGVVGGGAGVGG DSEGEVTSALSATFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHIL MRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFS GFLLYPDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | C1QL2 complement C1q like 2 [ Homo sapiens (human) ] |
Official Symbol | C1QL2 |
Synonyms | CTRP10; C1QTNF10 |
Gene ID | 165257 |
mRNA Refseq | NM_182528.4 |
Protein Refseq | NP_872334.2 |
MIM | 614330 |
UniProt ID | Q7Z5L3 |
◆ Recombinant Proteins | ||
C1QL2-1284HFL | Recombinant Full Length Human C1QL2 Protein, C-Flag-tagged | +Inquiry |
C1ql2-1908M | Recombinant Mouse C1ql2 Protein, Myc/DDK-tagged | +Inquiry |
C1QL2-1135M | Recombinant Mouse C1QL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QL2-416R | Recombinant Rhesus Macaque C1QL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QL2-466H | Recombinant Human C1QL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1QL2 Products
Required fields are marked with *
My Review for All C1QL2 Products
Required fields are marked with *
0
Inquiry Basket