Recombinant Full Length Human C2orf27B Protein, GST-tagged
Cat.No. : | C2orf27B-6428HF |
Product Overview : | Human MGC50273 full-length ORF ( NP_999626.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 209 amino acids |
Description : | C2orf27B (Chromosome 2 Open Reading Frame 27B) is a Protein Coding gene. An important paralog of this gene is C2orf27A. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C2orf27B chromosome 2 open reading frame 27B [ Homo sapiens (human) ] |
Official Symbol | C2orf27B |
Synonyms | C2orf27B; chromosome 2 open reading frame 27B; uncharacterized protein LOC408029 |
Gene ID | 408029 |
mRNA Refseq | NM_214461 |
Protein Refseq | NP_999626 |
UniProt ID | Q580R0 |
◆ Recombinant Proteins | ||
C2orf27B-5292H | Recombinant Human C2orf27B Protein, GST-tagged | +Inquiry |
C2orf27B-6428HF | Recombinant Full Length Human C2orf27B Protein, GST-tagged | +Inquiry |
C2orf27B-10513H | Recombinant Human C2orf27B, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf27B-8085HCL | Recombinant Human C2orf27B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C2orf27B Products
Required fields are marked with *
My Review for All C2orf27B Products
Required fields are marked with *