Recombinant Full Length Human C2orf62 Protein, GST-tagged

Cat.No. : C2orf62-6431HF
Product Overview : Human MGC50811 full-length ORF ( AAH52750, 1 a.a. - 387 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 387 amino acids
Description : CATIP (Ciliogenesis Associated TTC17 Interacting Protein) is a Protein Coding gene. GO annotations related to this gene include calmodulin binding.
Molecular Mass : 68.31 kDa
AA Sequence : MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEGDARSGAA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C2orf62 chromosome 2 open reading frame 62 [ Homo sapiens ]
Official Symbol C2orf62
Synonyms C2ORF62; chromosome 2 open reading frame 62; uncharacterized protein C2orf62; MGC50811;
Gene ID 375307
mRNA Refseq NM_198559
Protein Refseq NP_940961
MIM 619387
UniProt ID Q7Z7H3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C2orf62 Products

Required fields are marked with *

My Review for All C2orf62 Products

Required fields are marked with *

0
cart-icon
0
compare icon