Recombinant Full Length Human C2orf62 Protein, GST-tagged
Cat.No. : | C2orf62-6431HF |
Product Overview : | Human MGC50811 full-length ORF ( AAH52750, 1 a.a. - 387 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 387 amino acids |
Description : | CATIP (Ciliogenesis Associated TTC17 Interacting Protein) is a Protein Coding gene. GO annotations related to this gene include calmodulin binding. |
Molecular Mass : | 68.31 kDa |
AA Sequence : | MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEGDARSGAA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C2orf62 chromosome 2 open reading frame 62 [ Homo sapiens ] |
Official Symbol | C2orf62 |
Synonyms | C2ORF62; chromosome 2 open reading frame 62; uncharacterized protein C2orf62; MGC50811; |
Gene ID | 375307 |
mRNA Refseq | NM_198559 |
Protein Refseq | NP_940961 |
MIM | 619387 |
UniProt ID | Q7Z7H3 |
◆ Recombinant Proteins | ||
C2orf62-5294H | Recombinant Human C2orf62 Protein, GST-tagged | +Inquiry |
C2orf62-6431HF | Recombinant Full Length Human C2orf62 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2orf62-8069HCL | Recombinant Human C2orf62 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C2orf62 Products
Required fields are marked with *
My Review for All C2orf62 Products
Required fields are marked with *
0
Inquiry Basket