Recombinant Full Length Human C5orf34 Protein, GST-tagged
Cat.No. : | C5orf34-2668HF |
Product Overview : | Human C5orf34 full-length ORF (NP_940968.1, 1 a.a. - 638 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 638 amino acids |
Description : | C5orf34 (Chromosome 5 Open Reading Frame 34) is a Protein Coding gene. |
Molecular Mass : | 99.3 kDa |
AA Sequence : | MAAELRMILYEDDSVQVQYVDGSTLQLSPCGSEFLFEKSPPVSAHPLEQPERIRQRTHFVISTYREQLQRALDFRNSSATCPFLSETIIPSERKKHIFIDITEVRWPSLDTDGTMIYMESGIVKITSLDGHAYLCLPRSQHEFTVHFLCKVSQKSDSSAVLSETNNKAPKDKLVEKTGKICIRGNLPGQRLKNKENEFHCQIMKSKETLKKMSCVNGTEGREELPSPGTKHTCVYTWVKQCWSVAACPEEWKYPLSLALHFHNKISNMSKIDAHITQSRFLTSDISEERGKVVSVLPRALSLSCPVPHLHRWNFCDSLLQRQSDEYSYPELVKMVWYKGVTYRLTHQNMNSIEIYSGDGSVFKSEGAYFGNYFTYYSIQEGSGKREEKTYSVNNLPPDRPGSPFTVGSLIKQATRILQHCVKMRLSLSHNYRICCWKMVPGINDSNILPLVLKESLIPSVGRFLAYSDDKVHAIFLDGITLTLNWNFSSPIEKRQVNQGLNLGWCKLTFPDGQEQLIQIEHPEPYERYVTTVTSWCRRLTQTSPREMPTHSSSSVLQENWSVASELEKIQKFNLLLENSGILNQISNKKNEQQSFDHYKPGSSETLLGEVNENRVSIALKKTSEILHDIDCLLSNSKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C5orf34 chromosome 5 open reading frame 34 [ Homo sapiens ] |
Official Symbol | C5orf34 |
Synonyms | C5orf34; chromosome 5 open reading frame 34; uncharacterized protein C5orf34; Chromosome 5 Open Reading Frame 34 |
Gene ID | 375444 |
mRNA Refseq | NM_198566 |
Protein Refseq | NP_940968 |
UniProt ID | Q96MH7 |
◆ Recombinant Proteins | ||
C5orf34-2668HF | Recombinant Full Length Human C5orf34 Protein, GST-tagged | +Inquiry |
C5orf34-0086H | Recombinant Human C5orf34 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5orf34-8013HCL | Recombinant Human C5orf34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf34 Products
Required fields are marked with *
My Review for All C5orf34 Products
Required fields are marked with *