Recombinant Full Length Human C5orf56 Protein, GST-tagged
Cat.No. : | C5orf56-3919HF |
Product Overview : | Human C5orf56 full-length ORF ( ADR83475.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 126 amino acids |
Description : | C5orf56 (Chromosome 5 Open Reading Frame 56) is an RNA Gene, and is affiliated with the ncRNA class. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MDSLAAGELNASHQPWVPEFVAYWRKTHQGNLQTLLLHWLLLCSCLHHLYNASCHPAFPVEYSHAVCCLQPRFWKEMSPFSSSSTTHLFSKCFFYTCLCWAWQQCSSEQNHQPCSHAAYNQVERQT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C5orf56 chromosome 5 open reading frame 56 [ Homo sapiens (human) ] |
Official Symbol | C5orf56 |
Synonyms | LOC441108; C5orf56; chromosome 5 open reading frame 56; uncharacterized protein C5orf56 |
Gene ID | 441108 |
mRNA Refseq | NM_001207001 |
Protein Refseq | NP_001193930 |
UniProt ID | Q8N8D9 |
◆ Recombinant Proteins | ||
C5orf56-3919HF | Recombinant Full Length Human C5orf56 Protein, GST-tagged | +Inquiry |
C5orf56-5260H | Recombinant Human C5orf56 Protein, GST-tagged | +Inquiry |
C5orf56-1863H | Recombinant Human C5orf56 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5orf56-8006HCL | Recombinant Human C5orf56 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C5orf56 Products
Required fields are marked with *
My Review for All C5orf56 Products
Required fields are marked with *