Recombinant Full Length Human C5orf56 Protein, GST-tagged

Cat.No. : C5orf56-3919HF
Product Overview : Human C5orf56 full-length ORF ( ADR83475.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 126 amino acids
Description : C5orf56 (Chromosome 5 Open Reading Frame 56) is an RNA Gene, and is affiliated with the ncRNA class.
Molecular Mass : 13.9 kDa
AA Sequence : MDSLAAGELNASHQPWVPEFVAYWRKTHQGNLQTLLLHWLLLCSCLHHLYNASCHPAFPVEYSHAVCCLQPRFWKEMSPFSSSSTTHLFSKCFFYTCLCWAWQQCSSEQNHQPCSHAAYNQVERQT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C5orf56 chromosome 5 open reading frame 56 [ Homo sapiens (human) ]
Official Symbol C5orf56
Synonyms LOC441108; C5orf56; chromosome 5 open reading frame 56; uncharacterized protein C5orf56
Gene ID 441108
mRNA Refseq NM_001207001
Protein Refseq NP_001193930
UniProt ID Q8N8D9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C5orf56 Products

Required fields are marked with *

My Review for All C5orf56 Products

Required fields are marked with *

0
cart-icon