Recombinant Full Length Human C7orf49 Protein, GST-tagged
| Cat.No. : | C7orf49-2627HF |
| Product Overview : | Human C7orf49 full-length ORF (AAH00168.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 129 amino acids |
| Description : | C7orf49 (Chromosome 7 Open Reading Frame 49) is a Protein Coding gene. |
| Molecular Mass : | 40.59 kDa |
| AA Sequence : | MKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C7orf49 chromosome 7 open reading frame 49 [ Homo sapiens ] |
| Official Symbol | C7orf49 |
| Synonyms | C7ORF49; chromosome 7 open reading frame 49; modulator of retrovirus infection homolog; FLJ22450; FLJ27285; MGC5242; modulator of retrovirus infection; MRI; |
| Gene ID | 78996 |
| mRNA Refseq | NM_001243749 |
| Protein Refseq | NP_001230678 |
| MIM | 616980 |
| UniProt ID | Q9BWK5 |
| ◆ Recombinant Proteins | ||
| C7orf49-7593H | Recombinant Human C7orf49, His-tagged | +Inquiry |
| C7orf49-2627HF | Recombinant Full Length Human C7orf49 Protein, GST-tagged | +Inquiry |
| C7orf49-0149H | Recombinant Human C7orf49 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C7orf49-7964HCL | Recombinant Human C7orf49 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C7orf49 Products
Required fields are marked with *
My Review for All C7orf49 Products
Required fields are marked with *
