Recombinant Full Length Human C8B Protein, C-Flag-tagged
Cat.No. : | C8B-1903HFL |
Product Overview : | Recombinant Full Length Human C8B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of the three subunits of the complement component 8 (C8) protein. C8 is composed of equimolar amounts of alpha, beta and gamma subunits, which are encoded by three separate genes. C8 is one component of the membrane attack complex, which mediates cell lysis, and it initiates membrane penetration of the complex. This protein mediates the interaction of C8 with the C5b-7 membrane attack complex precursor. In humans deficiency of this protein is associated with increased risk of meningococcal infections. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.4 kDa |
AA Sequence : | MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTLMPIDCELSSW SSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLC NGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRF RKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIR RTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL GGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMK QALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGR RKTRQRQCNNPPPQNGGSPCSGPASETLDCS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways : | Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus |
Full Length : | Full L. |
Gene Name | C8B complement C8 beta chain [ Homo sapiens (human) ] |
Official Symbol | C8B |
Synonyms | C82 |
Gene ID | 732 |
mRNA Refseq | NM_000066.4 |
Protein Refseq | NP_000057.3 |
MIM | 120960 |
UniProt ID | P07358 |
◆ Recombinant Proteins | ||
C8B-618H | Recombinant Human C8B protein, His-tagged | +Inquiry |
C8B-476H | Recombinant Human C8B Protein, His (Fc)-Avi-tagged | +Inquiry |
C8B-713R | Recombinant Rat C8B Protein, His (Fc)-Avi-tagged | +Inquiry |
C8B-1903HFL | Recombinant Full Length Human C8B Protein, C-Flag-tagged | +Inquiry |
C8b-6788R | Recombinant Rat C8b protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C8B-7955HCL | Recombinant Human C8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C8B Products
Required fields are marked with *
My Review for All C8B Products
Required fields are marked with *
0
Inquiry Basket