Recombinant Full Length Human C8orf33 Protein, GST-tagged

• Cat.No.: C8orf33-4902HF
• Product Overview: Human FLJ20989 full-length ORF ( AAH10001, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 229 amino acids
• Description: C8orf33 (Chromosome 8 Open Reading Frame 33) is a Protein Coding gene.
• Molecular Mass: 50.93 kDa
• AA Sequence: MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C8orf33 chromosome 8 open reading frame 33 [ Homo sapiens ]
• Official Symbol: C8orf33
• Synonyms: C8ORF33; chromosome 8 open reading frame 33; UPF0488 protein C8orf33; FLJ20989
• Gene ID: 65265
• mRNA Refseq: NM_023080
• Protein Refseq: NP_075568
• UniProt ID: Q9H7E9