Recombinant Human C8orf33 Protein, GST-tagged
| Cat.No. : | C8orf33-4264H |
| Product Overview : | Human FLJ20989 full-length ORF ( AAH10001, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | C8orf33 (Chromosome 8 Open Reading Frame 33) is a Protein Coding gene. |
| Molecular Mass : | 50.93 kDa |
| AA Sequence : | MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C8orf33 chromosome 8 open reading frame 33 [ Homo sapiens ] |
| Official Symbol | C8orf33 |
| Synonyms | C8ORF33; chromosome 8 open reading frame 33; UPF0488 protein C8orf33; FLJ20989; |
| Gene ID | 65265 |
| mRNA Refseq | NM_023080 |
| Protein Refseq | NP_075568 |
| UniProt ID | Q9H7E9 |
| ◆ Recombinant Proteins | ||
| C8orf33-4264H | Recombinant Human C8orf33 Protein, GST-tagged | +Inquiry |
| C8orf33-4902HF | Recombinant Full Length Human C8orf33 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C8orf33-7953HCL | Recombinant Human C8orf33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8orf33 Products
Required fields are marked with *
My Review for All C8orf33 Products
Required fields are marked with *
