Recombinant Full Length Human C8orf4 Protein, GST-tagged
| Cat.No. : | C8orf4-2642HF |
| Product Overview : | Human C8orf4 full-length ORF (1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 106 amino acids |
| Description : | This gene encodes a small, monomeric, predominantly unstructured protein that functions as a positive regulator of the Wnt/beta-catenin signaling pathway. This protein interacts with a repressor of beta-catenin mediated transcription at nuclear speckles. It is thought to competitively block interactions of the repressor with beta-catenin, resulting in up-regulation of beta-catenin target genes. The encoded protein may also play a role in the NF-kappaB and ERK1/2 signaling pathways. Expression of this gene may play a role in the proliferation of several types of cancer including thyroid cancer, breast cancer and hematological malignancies. [provided by RefSeq, Nov 2011] |
| Molecular Mass : | 38.8 kDa |
| AA Sequence : | MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C8orf4 chromosome 8 open reading frame 4 [ Homo sapiens ] |
| Official Symbol | C8orf4 |
| Synonyms | TC1; TC-1 |
| Gene ID | 56892 |
| mRNA Refseq | NM_020130 |
| Protein Refseq | NP_064515 |
| MIM | 607702 |
| UniProt ID | Q9NR00 |
| ◆ Recombinant Proteins | ||
| C8orf4-2642HF | Recombinant Full Length Human C8orf4 Protein, GST-tagged | +Inquiry |
| C8orf4-0162H | Recombinant Human C8orf4 Protein, GST-Tagged | +Inquiry |
| C8orf4-4883H | Recombinant Human C8orf4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C8orf4-131HCL | Recombinant Human C8orf4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8orf4 Products
Required fields are marked with *
My Review for All C8orf4 Products
Required fields are marked with *
