Recombinant Full Length Human C8orf44 Protein, GST-tagged

Cat.No. : C8orf44-2644HF
Product Overview : Human C8orf44 full-length ORF (NP_062553.1, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 159 amino acids
Description : C8orf44 (Chromosome 8 Open Reading Frame 44) is a Protein Coding gene.
Molecular Mass : 44.8 kDa
AA Sequence : MRKNESYLNQPAPPIPIPTLSLMGGCREHFENHWKGRARWLMPVIPALWEAKAGRSPEVRSSKPAWPTWRNPIFTKNTKISQVLELFLNYQSLICALEKQKRQKGSLAIFCWSFQGGCVSKRPDVPSLKSQKPKRKRITGRKRLSKGFWSLLFSNLGRF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C8orf44 chromosome 8 open reading frame 44 [ Homo sapiens ]
Official Symbol C8orf44
Synonyms C8orf44; chromosome 8 open reading frame 44; putative uncharacterized protein C8orf44
Gene ID 56260
mRNA Refseq NM_019607
Protein Refseq NP_062553
UniProt ID Q96CB5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C8orf44 Products

Required fields are marked with *

My Review for All C8orf44 Products

Required fields are marked with *

0
cart-icon
0
compare icon