Recombinant Full Length Human C8orf46 Protein, GST-tagged

Cat.No. : C8orf46-2656HF
Product Overview : Human C8orf46 full-length ORF (NP_689978.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 206 amino acids
Description : C8orf46 (Chromosome 8 Open Reading Frame 46) is a Protein Coding gene.
Molecular Mass : 48.9 kDa
AA Sequence : MHQIYSCSDENIEVFTTVIPSKVSSPARRRAKSSQHLLTKNVVIESDLYTHQPLELLPHRGDRRDPGDRRRFGRLQTARPPTAHPAKASARPVGISEPKTSNLCGNRAYGKSLIPPVPRISVKTSASASLEATAMGTEKGAVLMRGSRHLKKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEAD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C8orf46 chromosome 8 open reading frame 46 [ Homo sapiens (human) ]
Official Symbol C8orf46
Synonyms C8orf46; chromosome 8 open reading frame 46; uncharacterized protein C8orf46; Chromosome 8 Open Reading Frame 46
Gene ID 254778
mRNA Refseq NM_152765
Protein Refseq NP_689978
UniProt ID Q8TAG6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C8orf46 Products

Required fields are marked with *

My Review for All C8orf46 Products

Required fields are marked with *

0
cart-icon
0
compare icon