Recombinant Full Length Human C8orf46 Protein, GST-tagged

• Cat.No.: C8orf46-2656HF
• Product Overview: Human C8orf46 full-length ORF (NP_689978.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 206 amino acids
• Description: C8orf46 (Chromosome 8 Open Reading Frame 46) is a Protein Coding gene.
• Molecular Mass: 48.9 kDa
• AA Sequence: MHQIYSCSDENIEVFTTVIPSKVSSPARRRAKSSQHLLTKNVVIESDLYTHQPLELLPHRGDRRDPGDRRRFGRLQTARPPTAHPAKASARPVGISEPKTSNLCGNRAYGKSLIPPVPRISVKTSASASLEATAMGTEKGAVLMRGSRHLKKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEAD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C8orf46 chromosome 8 open reading frame 46 [ Homo sapiens (human) ]
• Official Symbol: C8orf46
• Synonyms: C8orf46; chromosome 8 open reading frame 46; uncharacterized protein C8orf46; Chromosome 8 Open Reading Frame 46
• Gene ID: 254778
• mRNA Refseq: NM_152765
• Protein Refseq: NP_689978
• UniProt ID: Q8TAG6