Recombinant Full Length Human C8orf76 Protein, GST-tagged
Cat.No. : | C8orf76-2667HF |
Product Overview : | Human C8orf76 full-length ORF (NP_116236.1, 1 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 380 amino acids |
Description : | C8orf76 (Chromosome 8 Open Reading Frame 76) is a Protein Coding gene. An important paralog of this gene is ZHX1-C8orf76. |
Molecular Mass : | 69.7 kDa |
AA Sequence : | MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C8orf76 chromosome 8 open reading frame 76 [ Homo sapiens ] |
Official Symbol | C8orf76 |
Synonyms | C8ORF76; chromosome 8 open reading frame 76; uncharacterized protein C8orf76; FLJ14825; MGC9784; |
Gene ID | 84933 |
mRNA Refseq | NM_032847 |
Protein Refseq | NP_116236 |
UniProt ID | Q96K31 |
◆ Recombinant Proteins | ||
C8orf76-2667HF | Recombinant Full Length Human C8orf76 Protein, GST-tagged | +Inquiry |
C8orf76-0172H | Recombinant Human C8orf76 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C8orf76-259HCL | Recombinant Human C8orf76 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8orf76 Products
Required fields are marked with *
My Review for All C8orf76 Products
Required fields are marked with *