Recombinant Full Length Human C8orf76 Protein, GST-tagged
| Cat.No. : | C8orf76-2667HF | 
| Product Overview : | Human C8orf76 full-length ORF (NP_116236.1, 1 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 380 amino acids | 
| Description : | C8orf76 (Chromosome 8 Open Reading Frame 76) is a Protein Coding gene. An important paralog of this gene is ZHX1-C8orf76. | 
| Molecular Mass : | 69.7 kDa | 
| AA Sequence : | MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | C8orf76 chromosome 8 open reading frame 76 [ Homo sapiens ] | 
| Official Symbol | C8orf76 | 
| Synonyms | C8ORF76; chromosome 8 open reading frame 76; uncharacterized protein C8orf76; FLJ14825; MGC9784; | 
| Gene ID | 84933 | 
| mRNA Refseq | NM_032847 | 
| Protein Refseq | NP_116236 | 
| UniProt ID | Q96K31 | 
| ◆ Recombinant Proteins | ||
| C8orf76-0172H | Recombinant Human C8orf76 Protein, GST-Tagged | +Inquiry | 
| C8orf76-2667HF | Recombinant Full Length Human C8orf76 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C8orf76-259HCL | Recombinant Human C8orf76 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C8orf76 Products
Required fields are marked with *
My Review for All C8orf76 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            