Recombinant Full Length Human C8orf76 Protein, GST-tagged

Cat.No. : C8orf76-2667HF
Product Overview : Human C8orf76 full-length ORF (NP_116236.1, 1 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 380 amino acids
Description : C8orf76 (Chromosome 8 Open Reading Frame 76) is a Protein Coding gene. An important paralog of this gene is ZHX1-C8orf76.
Molecular Mass : 69.7 kDa
AA Sequence : MDSGCWLFGGEFEDSVFEERPERRSGPPASYCAKLCEPQWFYEETESSDDVEVLTLKKFKGDLAYRRQEYQKALQEYSSISEKLSSTNFAMKRDVQEGQARCLAHLGRHMEALEIAANLENKATNTDHLTTVLYLQLAICSSLQNLEKTIFCLQKLISLHPFNPWNWGKLAEAYLNLGPALSAALASSQKQHSFTSSDKTIKSFFPHSGKDCLLCFPETLPESSLFSVEANSSNSQKNEKALTNIQNCMAEKRETVLIETQLKACASFIRTRLLLQFTQPQQTSFALERNLRTQQEIEDKMKGFSFKEDTLLLIAEVMGEDIPEKIKDEVHPEVKCVGSVALTALVTVSSEEFEDKWFRKIKDHFCPFENQFHTEIQILA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C8orf76 chromosome 8 open reading frame 76 [ Homo sapiens ]
Official Symbol C8orf76
Synonyms C8ORF76; chromosome 8 open reading frame 76; uncharacterized protein C8orf76; FLJ14825; MGC9784;
Gene ID 84933
mRNA Refseq NM_032847
Protein Refseq NP_116236
UniProt ID Q96K31

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C8orf76 Products

Required fields are marked with *

My Review for All C8orf76 Products

Required fields are marked with *

0
cart-icon