Recombinant Full Length Human C9orf139 Protein, GST-tagged

Cat.No. : C9orf139-2686HF
Product Overview : Human C9orf139 full-length ORF (ADR83488.1, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 190 amino acids
Description : C9orf139 (Chromosome 9 Open Reading Frame 139) is a Protein Coding gene.
Molecular Mass : 20.9 kDa
AA Sequence : MALRGHPEPQPTNTPLSATVGGPISLFTQPRCHSAARDLVWSQAWPDPDVLEISMQTPGGSSCRKEAVLPRLRVTRPLVPEPAILPVCAARLAGSLATDLSRSHSLLPPWVDLKEPPPPSAPSLLLEDPGQGGCHGAQSCVGTCELANGARGFCPEMGQNESLSEEREGHESKRKSGGRGSPSSHPTQAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name C9orf139 chromosome 9 open reading frame 139 [ Homo sapiens ]
Official Symbol C9orf139
Synonyms C9orf139; chromosome 9 open reading frame 139; Chromosome 9 Open Reading Frame 139
Gene ID 401563
mRNA Refseq NM_207511
Protein Refseq NP_997394
UniProt ID Q6ZV77

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C9orf139 Products

Required fields are marked with *

My Review for All C9orf139 Products

Required fields are marked with *

0
cart-icon
0
compare icon