Recombinant Full Length Human C9orf40 Protein, GST-tagged
Cat.No. : | C9orf40-2698HF |
Product Overview : | Human C9orf40 full-length ORF (BAA91449.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 194 amino acids |
Description : | C9orf40 (Chromosome 9 Open Reading Frame 40) is a Protein Coding gene. |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MAKRRAAEPVTFHVPWKRLLLCDFAEQPPPPPLWIRPPGVAHAGQLLGVPEQHRKRKIDAGTMAEPSASPSKRRDSGDNSAPSGQEREDHGLETGDPPLPPPPVLPGPGEELPGARLPGDGGDDGAGRAGPPRGDWGVASCQHNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDMES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | C9orf40 chromosome 9 open reading frame 40 [ Homo sapiens ] |
Official Symbol | C9orf40 |
Synonyms | C9ORF40; chromosome 9 open reading frame 40; uncharacterized protein C9orf40; FLJ10110; FLJ25795; |
Gene ID | 55071 |
mRNA Refseq | NM_017998 |
Protein Refseq | NP_060468 |
UniProt ID | Q8IXQ3 |
◆ Recombinant Proteins | ||
C9orf40-2047H | Recombinant Human C9orf40 Protein, MYC/DDK-tagged | +Inquiry |
C9orf40-449H | Recombinant Human C9orf40 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C9orf40-0200H | Recombinant Human C9orf40 Protein, GST-Tagged | +Inquiry |
C9orf40-2698HF | Recombinant Full Length Human C9orf40 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf40 Products
Required fields are marked with *
My Review for All C9orf40 Products
Required fields are marked with *