Recombinant Full Length Human CA3 Protein, GST-tagged
Cat.No. : | CA3-2736HF |
Product Overview : | Human CA3 full-length ORF (AAH04897, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 260 amino acids |
Description : | Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encodes carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns. [provided by RefSeq, Oct 2008] |
Molecular Mass : | 54.34 kDa |
AA Sequence : | MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA3 carbonic anhydrase III, muscle specific [ Homo sapiens ] |
Official Symbol | CA3 |
Synonyms | CA3; carbonic anhydrase III, muscle specific; carbonic anhydrase 3; CAIII; Car3; CA-III; carbonate dehydratase III; FLJ36434; |
Gene ID | 761 |
mRNA Refseq | NM_005181 |
Protein Refseq | NP_005172 |
MIM | 114750 |
UniProt ID | P07451 |
◆ Recombinant Proteins | ||
CA3-0239H | Recombinant Human CA3 Protein, GST-Tagged | +Inquiry |
CA3-0188H | Recombinant Human CA3 Protein, His-tagged | +Inquiry |
CA3-35H | Recombinant Human carbonic anhydrase III, muscle specific, His-tagged | +Inquiry |
CA3-1159M | Recombinant Mouse CA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CA3-1051H | Recombinant Human CA3 Protein (M1-K260), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA3-7914HCL | Recombinant Human CA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA3 Products
Required fields are marked with *
My Review for All CA3 Products
Required fields are marked with *
0
Inquiry Basket