Recombinant Full Length Human CABP1 Protein, GST-tagged
Cat.No. : | CABP1-2763HF |
Product Overview : | Human CABP1 full-length ORF (AAH15006, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 304 amino acids |
Description : | Calcium binding proteins are an important component of calcium mediated cellular signal transduction. This gene encodes a protein that belongs to a subfamily of calcium binding proteins which share similarity to calmodulin. The protein encoded by this gene regulates the gating of voltage-gated calcium ion channels. This protein inhibits calcium-dependent inactivation and supports calcium-dependent facilitation of ion channels containing voltage-dependent L-type calcium channel subunit alpha-1C. This protein also regulates calcium-dependent activity of inositol 1,4,5-triphosphate receptors, P/Q-type voltage-gated calcium channels, and transient receptor potential channel TRPC5. This gene is predominantly expressed in retina and brain. Alternative splicing results in multiple transcript variants encoding disinct isoforms. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 59.18 kDa |
AA Sequence : | MCQCVRVCVCVCACATQRASHSALPGTTISVKDWRLCLLDQFDACARSGLSEPRSLTLRVPSCGKPLPGPGARLGREVTPCLSFAFAWCWLKMCQEEQTSYMVVQTSEEGLAADAELPGPLLMLAQNCAVMHNLLGPACIFLRKGFAENRQPDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CABP1 calcium binding protein 1; calbrain [ Homo sapiens ] |
Official Symbol | CABP1 |
Synonyms | CABP1; calcium binding protein 1; calbrain; |
Gene ID | 9478 |
mRNA Refseq | NM_001033677 |
Protein Refseq | NP_001028849 |
MIM | 605563 |
UniProt ID | Q9NZU7 |
◆ Recombinant Proteins | ||
Cabp1-1922M | Recombinant Mouse Cabp1 Protein, Myc/DDK-tagged | +Inquiry |
CABP1-2763HF | Recombinant Full Length Human CABP1 Protein, GST-tagged | +Inquiry |
CABP1-1118H | Recombinant Human CABP1 protein, His & T7-tagged | +Inquiry |
CABP1-2600M | Recombinant Mouse CABP1 Protein | +Inquiry |
CABP1-4916H | Recombinant Human CABP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CABP1 Products
Required fields are marked with *
My Review for All CABP1 Products
Required fields are marked with *
0
Inquiry Basket