Recombinant Full Length Human CALB2 Protein, GST-tagged
Cat.No. : | CALB2-3046HF |
Product Overview : | Human CALB2 full-length ORF (NP_009018.1, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 179 amino acids |
Description : | This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. It also functions as a modulator of neuronal excitability, and is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CALB2 calbindin 2 [ Homo sapiens ] |
Official Symbol | CALB2 |
Synonyms | CALB2; calbindin 2; calbindin 2, 29kDa (calretinin); calretinin; CAL2; calbindin D29K; 29 kDa calbindin; calbindin 2, (29kD, calretinin); CR; CAB29; |
Gene ID | 794 |
mRNA Refseq | NM_001740 |
Protein Refseq | NP_001731 |
MIM | 114051 |
UniProt ID | P22676 |
◆ Recombinant Proteins | ||
CALB2-1086R | Recombinant Rat CALB2 Protein | +Inquiry |
CALB2-6868C | Recombinant Chicken CALB2 | +Inquiry |
CALB2-486H | Recombinant Human CALB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CALB2-27214TH | Recombinant Human CALB2, His-tagged | +Inquiry |
Calb2-4911M | Recombinant Mouse Calbindin 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALB2-7896HCL | Recombinant Human CALB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALB2 Products
Required fields are marked with *
My Review for All CALB2 Products
Required fields are marked with *