Recombinant Human CALB2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CALB2-3362H
Product Overview : CALB2 MS Standard C13 and N15-labeled recombinant protein (NP_001731) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. It also functions as a modulator of neuronal excitability, and is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers. Alternative splicing results in multiple transcript variants.
Molecular Mass : 31.6 kDa
AA Sequence : MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSTEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CALB2 calbindin 2 [ Homo sapiens (human) ]
Official Symbol CALB2
Synonyms CALB2; calbindin 2; calbindin 2, 29kDa (calretinin); calretinin; CAL2; calbindin D29K; 29 kDa calbindin; calbindin 2, (29kD, calretinin); CR; CAB29;
Gene ID 794
mRNA Refseq NM_001740
Protein Refseq NP_001731
MIM 114051
UniProt ID P22676

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALB2 Products

Required fields are marked with *

My Review for All CALB2 Products

Required fields are marked with *

0
cart-icon