Recombinant Human CALB2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CALB2-3362H |
| Product Overview : | CALB2 MS Standard C13 and N15-labeled recombinant protein (NP_001731) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message targeting and intracellular calcium buffering. It also functions as a modulator of neuronal excitability, and is a diagnostic marker for some human diseases, including Hirschsprung disease and some cancers. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 31.6 kDa |
| AA Sequence : | MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSTEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CALB2 calbindin 2 [ Homo sapiens (human) ] |
| Official Symbol | CALB2 |
| Synonyms | CALB2; calbindin 2; calbindin 2, 29kDa (calretinin); calretinin; CAL2; calbindin D29K; 29 kDa calbindin; calbindin 2, (29kD, calretinin); CR; CAB29; |
| Gene ID | 794 |
| mRNA Refseq | NM_001740 |
| Protein Refseq | NP_001731 |
| MIM | 114051 |
| UniProt ID | P22676 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALB2 Products
Required fields are marked with *
My Review for All CALB2 Products
Required fields are marked with *



