Recombinant Full Length Human CALML3 Protein, GST-tagged

Cat.No. : CALML3-3065HF
Product Overview : Human CALML3 full-length ORF (AAH31889, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 149 amino acids
Description : CALML3 (Calmodulin Like 3) is a Protein Coding gene. Among its related pathways are Vascular smooth muscle contraction and Tuberculosis. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CALM1.
Molecular Mass : 42.13 kDa
AA Sequence : MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CALML3 calmodulin-like 3 [ Homo sapiens ]
Official Symbol CALML3
Synonyms CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP; caM-like protein; calmodulin-related protein NB-1;
Gene ID 810
mRNA Refseq NM_005185
Protein Refseq NP_005176
MIM 114184
UniProt ID P27482

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALML3 Products

Required fields are marked with *

My Review for All CALML3 Products

Required fields are marked with *

0
cart-icon