Recombinant Human CALML3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CALML3-1995H
• Product Overview: CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.
• Molecular Mass: 16.9 kDa
• AA Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CALML3 calmodulin-like 3 [ Homo sapiens (human) ]
• Official Symbol: CALML3
• Synonyms: CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP; caM-like protein; calmodulin-related protein NB-1
• Gene ID: 810
• mRNA Refseq: NM_005185
• Protein Refseq: NP_005176
• MIM: 114184
• UniProt ID: P27482