Recombinant Human CALML3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CALML3-1995H |
Product Overview : | CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates. |
Molecular Mass : | 16.9 kDa |
AA Sequence : | MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CALML3 calmodulin-like 3 [ Homo sapiens (human) ] |
Official Symbol | CALML3 |
Synonyms | CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP; caM-like protein; calmodulin-related protein NB-1; |
Gene ID | 810 |
mRNA Refseq | NM_005185 |
Protein Refseq | NP_005176 |
MIM | 114184 |
UniProt ID | P27482 |
◆ Recombinant Proteins | ||
CALML3-1995H | Recombinant Human CALML3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CALML3-7076H | Recombinant Human CALML3, His-tagged | +Inquiry |
CALML3-760R | Recombinant Rat CALML3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CALML3-10671H | Recombinant Human CALML3, GST-tagged | +Inquiry |
CALML3-1096R | Recombinant Rat CALML3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALML3-7887HCL | Recombinant Human CALML3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALML3 Products
Required fields are marked with *
My Review for All CALML3 Products
Required fields are marked with *
0
Inquiry Basket