Recombinant Full Length Human CAMK1 Protein, C-Flag-tagged
Cat.No. : | CAMK1-1541HFL |
Product Overview : | Recombinant Full Length Human CAMK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.2 kDa |
AA Sequence : | MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKEGSMENEIAVL HKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHR DLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYI LLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDT ALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCC CRDCCVEPGTELSPTLPHQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | CAMK1 calcium/calmodulin dependent protein kinase I [ Homo sapiens (human) ] |
Official Symbol | CAMK1 |
Synonyms | CAMKI |
Gene ID | 8536 |
mRNA Refseq | NM_003656.5 |
Protein Refseq | NP_003647.1 |
MIM | 604998 |
UniProt ID | Q14012 |
◆ Recombinant Proteins | ||
CAMK1-7206HF | Active Recombinant Full Length Human CAMK1 Protein, GST-tagged | +Inquiry |
CAMK1-441R | Recombinant Rhesus Macaque CAMK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMK1-489H | Recombinant Human CAMK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMK1-613R | Recombinant Rhesus monkey CAMK1 Protein, His-tagged | +Inquiry |
CAMK1-1372M | Active Recombinant Mouse CAMK1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK1-7883HCL | Recombinant Human CAMK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAMK1 Products
Required fields are marked with *
My Review for All CAMK1 Products
Required fields are marked with *
0
Inquiry Basket