Recombinant Full Length Human CAMP Protein, GST-tagged
| Cat.No. : | CAMP-2795HF |
| Product Overview : | Human CAMP full-length ORF (NP_004336.2, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 170 amino acids |
| Description : | This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 45.7 kDa |
| AA Sequence : | MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CAMP cathelicidin antimicrobial peptide [ Homo sapiens ] |
| Official Symbol | CAMP |
| Synonyms | CAMP; cathelicidin antimicrobial peptide; CAP18; FALL 39; FALL39; LL37; 18 kDa cationic antimicrobial protein; CRAMP; HSD26; CAP-18; FALL-39; |
| Gene ID | 820 |
| mRNA Refseq | NM_004345 |
| Protein Refseq | NP_004336 |
| MIM | 600474 |
| UniProt ID | P49913 |
| ◆ Recombinant Proteins | ||
| CAMP-10691H | Recombinant Human CAMP, GST-tagged | +Inquiry |
| CAMP-2677M | Recombinant Mouse CAMP Protein | +Inquiry |
| CAMP-7577H | Recombinant Human CAMP, His-tagged | +Inquiry |
| CAMP-2767H | Recombinant Human CAMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CAMP-619R | Recombinant Rhesus monkey CAMP Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMP Products
Required fields are marked with *
My Review for All CAMP Products
Required fields are marked with *
