Recombinant Full Length Human CAP2 Protein, C-Flag-tagged
Cat.No. : | CAP2-2120HFL |
Product Overview : | Recombinant Full Length Human CAP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene was identified by its similarity to the gene for human adenylyl cyclase-associated protein. The function of the protein encoded by this gene is unknown. However, the protein appears to be able to interact with adenylyl cyclase-associated protein and actin. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.6 kDa |
AA Sequence : | MANMQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGVAPSVEAFDKLMDSMVAEFLKNSRILAGD VETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRGSNMFNHLSAVSESI PALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWSELQAYIKEHHTTGLTWS KTGPVASTVSAFSVLSSGPGLPPPPPPLPPPGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHV TDDQKTYKNPSLRAQGGQTQSPTKSHTPSPTSPKSYPSQKHAPVLELEGKKWRVEYQEDRNDLVISETEL KQVAYIFKCEKSTIQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCH IYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPIPEQFKTAWDGSKLITEPAEIMA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CAP2 cyclase associated actin cytoskeleton regulatory protein 2 [ Homo sapiens (human) ] |
Official Symbol | CAP2 |
Synonyms | adenylyl cyclase-associated protein 2 |
Gene ID | 10486 |
mRNA Refseq | NM_006366.3 |
Protein Refseq | NP_006357.1 |
MIM | 618385 |
UniProt ID | P40123 |
◆ Recombinant Proteins | ||
Cap2-3080M | Recombinant Mouse Cap2 protein, His-tagged | +Inquiry |
CAP2-11090Z | Recombinant Zebrafish CAP2 | +Inquiry |
CAP2-0695H | Recombinant Human CAP2 Protein (Met1-Ala477), N-His tagged | +Inquiry |
CAP2-3193H | Recombinant Human CAP2, His-tagged | +Inquiry |
CAP2-10697H | Recombinant Human CAP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAP2-7867HCL | Recombinant Human CAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAP2 Products
Required fields are marked with *
My Review for All CAP2 Products
Required fields are marked with *
0
Inquiry Basket