Recombinant Full Length Human CAPNS2 Protein, GST-tagged

Cat.No. : CAPNS2-2831HF
Product Overview : Human CAPNS2 full-length ORF (AAH05397, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 248 amino acids
Description : CAPNS2 (Calpain Small Subunit 2) is a Protein Coding gene. Among its related pathways are Degradation of the extracellular matrix and Neurodegenerative Diseases. GO annotations related to this gene include calcium ion binding and calcium-dependent cysteine-type endopeptidase activity. An important paralog of this gene is CAPNS1.
Molecular Mass : 53.02 kDa
AA Sequence : MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEPPPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFSLDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKEWLQLTMYS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CAPNS2 calpain, small subunit 2 [ Homo sapiens ]
Official Symbol CAPNS2
Synonyms CAPNS2; calpain, small subunit 2; calpain small subunit 2; MGC12536; MGC14804; CSS2; calcium-dependent protease small subunit 2;
Gene ID 84290
mRNA Refseq NM_032330
Protein Refseq NP_115706
UniProt ID Q96L46

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CAPNS2 Products

Required fields are marked with *

My Review for All CAPNS2 Products

Required fields are marked with *

0
cart-icon