Recombinant Full Length Human CAPZA2 Protein, C-Flag-tagged
Cat.No. : | CAPZA2-2095HFL |
Product Overview : | Recombinant Full Length Human CAPZA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin filaments at the barbed end. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGY EDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGV CTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYEDGNVQLVSHK DIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG KEMQNA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CAPZA2 capping actin protein of muscle Z-line subunit alpha 2 [ Homo sapiens (human) ] |
Official Symbol | CAPZA2 |
Synonyms | CAPZ; CAPPA2 |
Gene ID | 830 |
mRNA Refseq | NM_006136.3 |
Protein Refseq | NP_006127.1 |
MIM | 601571 |
UniProt ID | P54710 |
◆ Recombinant Proteins | ||
CAPZA2-2095HFL | Recombinant Full Length Human CAPZA2 Protein, C-Flag-tagged | +Inquiry |
Capza2-763M | Recombinant Mouse Capza2 Protein, MYC/DDK-tagged | +Inquiry |
CAPZA2-360C | Recombinant Cynomolgus CAPZA2 Protein, His-tagged | +Inquiry |
CAPZA2-2851HF | Recombinant Full Length Human CAPZA2 Protein, GST-tagged | +Inquiry |
CAPZA2-793R | Recombinant Rat CAPZA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPZA2-7852HCL | Recombinant Human CAPZA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPZA2 Products
Required fields are marked with *
My Review for All CAPZA2 Products
Required fields are marked with *