Recombinant Full Length Human CASC3 Protein, C-Flag-tagged
Cat.No. : | CASC3-1462HFL |
Product Overview : | Recombinant Full Length Human CASC3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene is a core component of the exon junction complex (EJC), a protein complex that is deposited on spliced mRNAs at exon-exon junctions and functions in nonsense-mediated mRNA decay (NMD). The encoded protein binds RNA and interacts with two other EJC core components. It is predominantly located in the cytoplasm, but shuttles into the nucleus where it localizes to nuclear speckles. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 76.1 kDa |
AA Sequence : | MADRRRQRASQDTEDEESGASGSDSGGSPLRGGGSCSGSAGGGGSGSLPSQRGGRTGALHLRRVESGGAK SAEESECESEDGIEGDAVLSDYESAEDSEGEEGEYSEEENSKVELKSEANDAVNSSTKEEKGEEKPDTKS TVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRK LWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHNPDDIKPRRIRKPRYGSPPQRDPNWNGERLNK SHRHQGLGGTLPPRTFINRNAAGTGRMSAPRNYSRSGGFKEGRAGFRPVEAGGQHGGRSGETVKHEISYR SRRLEQTSVRDPSPEADAPVLGSPEKEEAASEPPAAAPDAAPPPPDRPIEKKSYSRARRTRTKVGDAVKL AEEVPPPPEGLIPAPPVPETTPTPPTKTGTWEAPVDSSTSGLEQDVAQLNIAEQNWSPGQPSFLQPRELR GMPNHIHMGAGPPPQFNRMEEMGVQGGRAKRYSSQRQRPVPEPPAPPVHISIMEGHYYDPLQFQGPIYTH GDSPAPLPPQGMLVQPGMNLPHPGLHPHQTPAPLPNPGLYPPPVSMSPGQPPPQQLLAPTYFSAPGVMNF GNPSYPYAPGALPPPPPPHLYPNTQAPSQVYGGVTYYNPAQQQVQPKPSPPRRTPQPVTIKPPPPEVVSR GSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CASC3 CASC3 exon junction complex subunit [ Homo sapiens (human) ] |
Official Symbol | CASC3 |
Synonyms | BTZ; MLN51 |
Gene ID | 22794 |
mRNA Refseq | NM_007359.5 |
Protein Refseq | NP_031385.2 |
MIM | 606504 |
UniProt ID | O15234 |
◆ Recombinant Proteins | ||
CASC3-799R | Recombinant Rat CASC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASC3-2741M | Recombinant Mouse CASC3 Protein | +Inquiry |
CASC3-459R | Recombinant Rhesus Macaque CASC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASC3-0408H | Recombinant Human CASC3 Protein, GST-Tagged | +Inquiry |
CASC3-1462HFL | Recombinant Full Length Human CASC3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASC3-7844HCL | Recombinant Human CASC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CASC3 Products
Required fields are marked with *
My Review for All CASC3 Products
Required fields are marked with *
0
Inquiry Basket