Recombinant Full Length Human CAST Protein, GST-tagged
| Cat.No. : | CAST-2751HF | 
| Product Overview : | Human CAST full-length ORF (NP_775083.1, 1 a.a. - 686 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 686 amino acids | 
| Description : | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] | 
| Molecular Mass : | 100.5 kDa | 
| AA Sequence : | MNPTETKAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CAST calpastatin [ Homo sapiens ] | 
| Official Symbol | CAST | 
| Synonyms | CAST; calpastatin; calpain inhibitor; sperm BS-17 component; BS-17; MGC9402; | 
| Gene ID | 831 | 
| mRNA Refseq | NM_001042440 | 
| Protein Refseq | NP_001035905 | 
| MIM | 114090 | 
| UniProt ID | P20810 | 
| ◆ Recombinant Proteins | ||
| CAST-1149R | Recombinant Rat CAST Protein | +Inquiry | 
| CAST-50HF | Recombinant Full Length Human CAST Protein | +Inquiry | 
| CAST-628H | Recombinant Human CAST Protein, His&GST-tagged | +Inquiry | 
| CAST-1434H | Recombinant Human CAST Protein (Ala446-Lys636), N-His tagged | +Inquiry | 
| CAST-27210TH | Recombinant Human CAST | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CAST-7824HCL | Recombinant Human CAST 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAST Products
Required fields are marked with *
My Review for All CAST Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            