Recombinant Full Length Human CAV2 Protein, GST-tagged
Cat.No. : | CAV2-2754HF |
Product Overview : | Human CAV2 full-length ORF (NP_001224.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 162 amino acids |
Description : | The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462). [provided by RefSeq, May 2011] |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAV2 caveolin 2 [ Homo sapiens ] |
Official Symbol | CAV2 |
Synonyms | CAV2; caveolin 2; caveolin-2; CAV; caveolae protein, 20-kD; caveolin 2 isoform a and b; MGC12294; |
Gene ID | 858 |
mRNA Refseq | NM_001206747 |
Protein Refseq | NP_001193676 |
MIM | 601048 |
UniProt ID | P51636 |
◆ Recombinant Proteins | ||
CAV2-2598H | Recombinant Human CAV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV2-51HF | Recombinant Full Length Human CAV2 Protein | +Inquiry |
CAV2-1259M | Recombinant Mouse CAV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cav2-781M | Recombinant Mouse Cav2 Protein, MYC/DDK-tagged | +Inquiry |
CAV2-635R | Recombinant Rhesus monkey CAV2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAV2-7820HCL | Recombinant Human CAV2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAV2 Products
Required fields are marked with *
My Review for All CAV2 Products
Required fields are marked with *
0
Inquiry Basket