Recombinant Full Length Human CBX5 Protein, C-Flag-tagged
Cat.No. : | CBX5-2036HFL |
Product Overview : | Recombinant Full Length Human CBX5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22 kDa |
AA Sequence : | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKY KKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLM KWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CBX5 chromobox 5 [ Homo sapiens (human) ] |
Official Symbol | CBX5 |
Synonyms | HP1; HP1A; HEL25 |
Gene ID | 23468 |
mRNA Refseq | NM_012117.3 |
Protein Refseq | NP_036249.1 |
MIM | 604478 |
UniProt ID | P45973 |
◆ Recombinant Proteins | ||
CBX5-1272M | Recombinant Mouse CBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBX5-5041Z | Recombinant Zebrafish CBX5 | +Inquiry |
CBX5-1112H | Recombinant Human CBX5 protein, His&Myc-tagged | +Inquiry |
CBX5-2781HF | Recombinant Full Length Human CBX5 Protein, GST-tagged | +Inquiry |
CBX5-2036HFL | Recombinant Full Length Human CBX5 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX5-7802HCL | Recombinant Human CBX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBX5 Products
Required fields are marked with *
My Review for All CBX5 Products
Required fields are marked with *
0
Inquiry Basket