Recombinant Full Length Human CBX7 Protein, GST-tagged
Cat.No. : | CBX7-2783HF |
Product Overview : | Human CBX7 full-length ORF (NP_783640.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 251 amino acids |
Description : | This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided by RefSeq, Oct 2016] |
Molecular Mass : | 54.7 kDa |
AA Sequence : | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CBX7 chromobox homolog 7 [ Homo sapiens ] |
Official Symbol | CBX7 |
Synonyms | CBX7; chromobox homolog 7; chromobox protein homolog 7; |
Gene ID | 23492 |
mRNA Refseq | NM_175709 |
Protein Refseq | NP_783640 |
MIM | 608457 |
UniProt ID | O95931 |
◆ Recombinant Proteins | ||
CBX7-2783HF | Recombinant Full Length Human CBX7 Protein, GST-tagged | +Inquiry |
CBX7-0485H | Recombinant Human CBX7 Protein, GST-Tagged | +Inquiry |
CBX7-649R | Recombinant Rhesus monkey CBX7 Protein, His-tagged | +Inquiry |
CBX7-821R | Recombinant Rat CBX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBX7-1274M | Recombinant Mouse CBX7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX7-7801HCL | Recombinant Human CBX7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBX7 Products
Required fields are marked with *
My Review for All CBX7 Products
Required fields are marked with *
0
Inquiry Basket