Recombinant Full Length Human CCDC117 Protein, GST-tagged
| Cat.No. : | CCDC117-2829HF |
| Product Overview : | Human CCDC117 full-length ORF (CAK54443.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 170 amino acids |
| Description : | CCDC117 (Coiled-Coil Domain Containing 117) is a Protein Coding gene. |
| Molecular Mass : | 45.1 kDa |
| AA Sequence : | MAALGRPFSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC117 coiled-coil domain containing 117 [ Homo sapiens ] |
| Official Symbol | CCDC117 |
| Synonyms | CCDC117; coiled-coil domain containing 117; coiled-coil domain-containing protein 117; FLJ33814; dJ366L4.1; |
| Gene ID | 150275 |
| mRNA Refseq | NM_173510 |
| Protein Refseq | NP_775781 |
| UniProt ID | Q8IWD4 |
| ◆ Recombinant Proteins | ||
| CCDC117-2829HF | Recombinant Full Length Human CCDC117 Protein, GST-tagged | +Inquiry |
| Ccdc117-264M | Recombinant Mouse Ccdc117 Protein, MYC/DDK-tagged | +Inquiry |
| CCDC117-2823M | Recombinant Mouse CCDC117 Protein | +Inquiry |
| CCDC117-0516H | Recombinant Human CCDC117 Protein, GST-Tagged | +Inquiry |
| CCDC117-2496H | Recombinant Human CCDC117 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC117-7786HCL | Recombinant Human CCDC117 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC117 Products
Required fields are marked with *
My Review for All CCDC117 Products
Required fields are marked with *
