Recombinant Full Length Human CCDC117 Protein, GST-tagged
Cat.No. : | CCDC117-2829HF |
Product Overview : | Human CCDC117 full-length ORF (CAK54443.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 170 amino acids |
Description : | CCDC117 (Coiled-Coil Domain Containing 117) is a Protein Coding gene. |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MAALGRPFSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC117 coiled-coil domain containing 117 [ Homo sapiens ] |
Official Symbol | CCDC117 |
Synonyms | CCDC117; coiled-coil domain containing 117; coiled-coil domain-containing protein 117; FLJ33814; dJ366L4.1; |
Gene ID | 150275 |
mRNA Refseq | NM_173510 |
Protein Refseq | NP_775781 |
UniProt ID | Q8IWD4 |
◆ Recombinant Proteins | ||
CCDC117-829R | Recombinant Rat CCDC117 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC117-0516H | Recombinant Human CCDC117 Protein, GST-Tagged | +Inquiry |
Ccdc117-264M | Recombinant Mouse Ccdc117 Protein, MYC/DDK-tagged | +Inquiry |
CCDC117-2829HF | Recombinant Full Length Human CCDC117 Protein, GST-tagged | +Inquiry |
CCDC117-1171R | Recombinant Rat CCDC117 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC117-7786HCL | Recombinant Human CCDC117 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC117 Products
Required fields are marked with *
My Review for All CCDC117 Products
Required fields are marked with *