Recombinant Full Length Human CCDC97 Protein, GST-tagged

Cat.No. : CCDC97-2913HF
Product Overview : Human CCDC97 full-length ORF (NP_443080.1, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 343 amino acids
Description : CCDC97 (Coiled-Coil Domain Containing 97) is a Protein Coding gene.
Molecular Mass : 65.3 kDa
AA Sequence : MEAVATATAAKEPDKGCIEPGPGHWGELSRTPVPSKPQDKVEAAEATPVALDSDTSGAENAAVSAMLHAVAASRLPVCSQQQGEPDLTEHEKVAILAQLYHEKPLVFLERFRTGLREEHLACFGHVRGDHRADFYCAEVARQGTARPRTLRTRLRNRRYAALRELIQGGEYFSDEQMRFRAPLLYEQYIGQYLTQEELSARTPTHQPPKPGSPGRPACPLSNLLLQSYEERELQQRLLQQQEEEEACLEEEEEEEDSDEEDQRSGKDSEAWVPDSEERLILREEFTSRMHQRFLDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC97 coiled-coil domain containing 97 [ Homo sapiens ]
Official Symbol CCDC97
Synonyms CCDC97; coiled-coil domain containing 97
Gene ID 90324
mRNA Refseq NM_052848
Protein Refseq NP_443080
UniProt ID Q96F63

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC97 Products

Required fields are marked with *

My Review for All CCDC97 Products

Required fields are marked with *

0
cart-icon