Recombinant Full Length Human CCL1 Protein, GST-tagged
Cat.No. : | CCL1-2918HF |
Product Overview : | Human CCL1 full-length ORF (NP_002972.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 96 amino acids |
Description : | This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine (C-C motif) receptor 8. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ] |
Official Symbol | CCL1 |
Synonyms | CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1; |
Gene ID | 6346 |
mRNA Refseq | NM_002981 |
Protein Refseq | NP_002972 |
MIM | 182281 |
UniProt ID | P22362 |
◆ Recombinant Proteins | ||
CCL1-678R | Recombinant Rhesus monkey CCL1 Protein, His-tagged | +Inquiry |
CCL1-214H | Recombinant Human CCL1 Protein, DYKDDDDK-tagged | +Inquiry |
CCL1-0883H | Recombinant Human CCL1 Protein (Lys24-Lys96), N-GST tagged | +Inquiry |
CCL1-6340C | Recombinant Chicken CCL1 | +Inquiry |
Ccl1-640R | Recombinant Rat Ccl1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL1-3060HCL | Recombinant Human CCL1 cell lysate | +Inquiry |
CCL1-1690MCL | Recombinant Mouse CCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL1 Products
Required fields are marked with *
My Review for All CCL1 Products
Required fields are marked with *