Recombinant Full Length Human CCL1 Protein, GST-tagged

• Cat.No.: CCL1-2918HF
• Product Overview: Human CCL1 full-length ORF (NP_002972.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 96 amino acids
• Description: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine (C-C motif) receptor 8. [provided by RefSeq, Sep 2014]
• Molecular Mass: 37.4 kDa
• AA Sequence: MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ]
• Official Symbol: CCL1
• Synonyms: CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1
• Gene ID: 6346
• mRNA Refseq: NM_002981
• Protein Refseq: NP_002972
• MIM: 182281
• UniProt ID: P22362