Recombinant Full Length Human CCL24 Protein, GST-tagged
Cat.No. : | CCL24-2932HF |
Product Overview : | Human CCL24 full-length ORF (NP_002982.2, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 119 amino acids |
Description : | This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 39.5 kDa |
AA Sequence : | MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL24 chemokine (C-C motif) ligand 24 [ Homo sapiens ] |
Official Symbol | CCL24 |
Synonyms | CCL24; chemokine (C-C motif) ligand 24; SCYA24, small inducible cytokine subfamily A (Cys Cys), member 24; C-C motif chemokine 24; CK beta 6; Ckb 6; eotaxin 2; MPIF 2; MPIF2; myeloid progenitor inhibitory factor 2; CK-beta-6; eotaxin-2; small-inducible cytokine A24; eosinophil chemotactic protein 2; small inducible cytokine subfamily A (Cys-Cys), member 24; Ckb-6; MPIF-2; SCYA24; |
Gene ID | 6369 |
mRNA Refseq | NM_002991 |
Protein Refseq | NP_002982 |
MIM | 602495 |
UniProt ID | O00175 |
◆ Recombinant Proteins | ||
CCL24-2932HF | Recombinant Full Length Human CCL24 Protein, GST-tagged | +Inquiry |
Ccl24-1348M | Active Recombinant Mouse Ccl24 Protein | +Inquiry |
CCL24-0885H | Recombinant Human CCL24 Protein (Val27-Cys119), His tagged | +Inquiry |
CCL24-036H | Active Recombinant Human CCL24 Protein, hFc-tagged | +Inquiry |
CCL24-1294H | Recombinant Human CCL24 Protein (Val27-Cys119), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL24-437HCL | Recombinant Human CCL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL24 Products
Required fields are marked with *
My Review for All CCL24 Products
Required fields are marked with *
0
Inquiry Basket