Recombinant Full Length Human CCNL1 Protein, GST-tagged

Cat.No. : CCNL1-2981HF
Product Overview : Human CCNL1 full-length ORF (AAH38394, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 172 amino acids
Description : CCNL1 (Cyclin L1) is a Protein Coding gene. Diseases associated with CCNL1 include Squamous Cell Carcinoma, Head And Neck. GO annotations related to this gene include protein kinase binding. An important paralog of this gene is CCNL2.
Molecular Mass : 44.66 kDa
AA Sequence : MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVFHHLRQLRGKSDQLHLPKPG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCNL1 cyclin L1 [ Homo sapiens ]
Official Symbol CCNL1
Synonyms CCNL1; cyclin L1; cyclin-L1; ania 6a; cyclin-L; cyclin L gamma; cyclin L ania-6a; ANIA6A; BM-001; PRO1073; ania-6a;
Gene ID 57018
mRNA Refseq NM_020307
Protein Refseq NP_064703
MIM 613384
UniProt ID Q9UK58

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCNL1 Products

Required fields are marked with *

My Review for All CCNL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon