Recombinant Full Length Human CCNL1 Protein, GST-tagged
| Cat.No. : | CCNL1-2981HF | 
| Product Overview : | Human CCNL1 full-length ORF (AAH38394, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 172 amino acids | 
| Description : | CCNL1 (Cyclin L1) is a Protein Coding gene. Diseases associated with CCNL1 include Squamous Cell Carcinoma, Head And Neck. GO annotations related to this gene include protein kinase binding. An important paralog of this gene is CCNL2. | 
| Molecular Mass : | 44.66 kDa | 
| AA Sequence : | MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVFHHLRQLRGKSDQLHLPKPG | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CCNL1 cyclin L1 [ Homo sapiens ] | 
| Official Symbol | CCNL1 | 
| Synonyms | CCNL1; cyclin L1; cyclin-L1; ania 6a; cyclin-L; cyclin L gamma; cyclin L ania-6a; ANIA6A; BM-001; PRO1073; ania-6a; | 
| Gene ID | 57018 | 
| mRNA Refseq | NM_020307 | 
| Protein Refseq | NP_064703 | 
| MIM | 613384 | 
| UniProt ID | Q9UK58 | 
| ◆ Recombinant Proteins | ||
| CCNL1-2981HF | Recombinant Full Length Human CCNL1 Protein, GST-tagged | +Inquiry | 
| CCNL1-0678H | Recombinant Human CCNL1 Protein, GST-Tagged | +Inquiry | 
| CCNL1-3002M | Recombinant Mouse CCNL1 Protein | +Inquiry | 
| CCNL1-1413M | Recombinant Mouse CCNL1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CCNL1-307HCL | Recombinant Human CCNL1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNL1 Products
Required fields are marked with *
My Review for All CCNL1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            