Recombinant Full Length Human CCNQ Protein, GST-tagged
| Cat.No. : | CCNQ-4620HF |
| Product Overview : | Human FAM58A full-length ORF ( NP_689487.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 214 amino acids |
| Description : | Mutations in this gene have been shown to cause an X-linked dominant STAR syndrome that typically manifests syndactyly, telecanthus and anogenital and renal malformations. The protein encoded by this gene contains a cyclin-box-fold domain which suggests it may have a role in controlling nuclear cell division cycles. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008] |
| Molecular Mass : | 51.3 kDa |
| AA Sequence : | MEAGVKLGMRSIPIATACTIYHKFFCETNLDAYDPYLIAMSSIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHGALCLRFQAQHIAVAVLYLALQVYGVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTEIP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCNQ cyclin Q [ Homo sapiens (human) ] |
| Official Symbol | CCNQ |
| Synonyms | CCNQ; cyclin Q; Family With Sequence Similarity 58 Member A; CDK10-Activating Cyclin; Cyclin Q; Family With Sequence Similarity 58, Member A; Cyclin-Related Protein FAM58A; Cyclin M; Cyclin-M; STAR; cyclin-related protein FAM58A; CDK10-activating cyclin; cyclin M; family with sequence similarity 58 member A |
| Gene ID | 92002 |
| mRNA Refseq | NM_001130997 |
| Protein Refseq | NP_001124469 |
| MIM | 300708 |
| UniProt ID | Q8N1B3 |
| ◆ Recombinant Proteins | ||
| CCNQ-28H | Recombinant Human CCNQ Protein (Full length), N-GST-tagged | +Inquiry |
| CCNQ-3782H | Recombinant Human CCNQ Protein, GST-tagged | +Inquiry |
| CCNQ-4620HF | Recombinant Full Length Human CCNQ Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNQ Products
Required fields are marked with *
My Review for All CCNQ Products
Required fields are marked with *
