Recombinant Full Length Human CD14 Protein, C-Flag-tagged
Cat.No. : | CD14-1211HFL |
Product Overview : | Recombinant Full Length Human CD14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38 kDa |
AA Sequence : | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFL KRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEAT GLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGER GLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNS LNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP ACARSTLSVGVSGTLVLLQGARGFATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways : | Hematopoietic cell lineage, MAPK signaling pathway, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | CD14 CD14 molecule [ Homo sapiens (human) ] |
Official Symbol | CD14 |
Synonyms | CD14 antigen; CD14 molecule; monocyte differentiation antigen CD14 |
Gene ID | 929 |
mRNA Refseq | NM_000591.4 |
Protein Refseq | NP_000582.1 |
MIM | 158120 |
UniProt ID | P08571 |
◆ Recombinant Proteins | ||
CD14-1235R | Recombinant Rat CD14 Protein | +Inquiry |
CD14-1101R | Recombinant Rat CD14 Protein, His-tagged | +Inquiry |
CD14-28H | Recombinant Human CD14, His-tagged | +Inquiry |
CD14-789H | Recombinant Human CD14 protein, His-tagged | +Inquiry |
CD14-4993H | Recombinant Human CD14 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
CD14-2581MCL | Recombinant Mouse CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD14 Products
Required fields are marked with *
My Review for All CD14 Products
Required fields are marked with *
0
Inquiry Basket