Recombinant Full Length Human CD14 Protein, GST-tagged
Cat.No. : | CD14-2944HF |
Product Overview : | Human CD14 full-length ORF (AAH10507, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 375 amino acids |
Description : | The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Mar 2010] |
Molecular Mass : | 66.99 kDa |
AA Sequence : | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQDLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD14 CD14 molecule [ Homo sapiens ] |
Official Symbol | CD14 |
Synonyms | CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; |
Gene ID | 929 |
mRNA Refseq | NM_000591 |
Protein Refseq | NP_000582 |
MIM | 158120 |
UniProt ID | P08571 |
◆ Recombinant Proteins | ||
Cd14-117M | Active Recombinant Mouse Cd14 Protein, Fc-tagged | +Inquiry |
CD14-4823H | Active Recombinant Human CD14 protein, mFc-tagged | +Inquiry |
Cd14-7484R | Recombinant Rat Cd14 protein(Met1-Tyr341), hFc-tagged | +Inquiry |
CD14-1291H | Recombinant Human CD14 Protein (Thr20-Leu368), His tagged | +Inquiry |
CD14-790P | Recombinant Pig CD14 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
CD14-2581MCL | Recombinant Mouse CD14 cell lysate | +Inquiry |
CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD14 Products
Required fields are marked with *
My Review for All CD14 Products
Required fields are marked with *