Recombinant Full Length Human CD14 Protein, GST-tagged
| Cat.No. : | CD14-2944HF |
| Product Overview : | Human CD14 full-length ORF (AAH10507, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 375 amino acids |
| Description : | The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Mar 2010] |
| Molecular Mass : | 66.99 kDa |
| AA Sequence : | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQDLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CD14 CD14 molecule [ Homo sapiens ] |
| Official Symbol | CD14 |
| Synonyms | CD14; CD14 molecule; CD14 antigen; monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein; |
| Gene ID | 929 |
| mRNA Refseq | NM_000591 |
| Protein Refseq | NP_000582 |
| MIM | 158120 |
| UniProt ID | P08571 |
| ◆ Recombinant Proteins | ||
| CD14-6224H | Recombinant Human CD14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CD14-1291H | Recombinant Human CD14 Protein (Thr20-Leu368), His tagged | +Inquiry |
| CD14-1235R | Recombinant Rat CD14 Protein | +Inquiry |
| CD14-613H | Recombinant Human CD14 protein, hFc-tagged | +Inquiry |
| CD14-893R | Recombinant Rat CD14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD14-2581MCL | Recombinant Mouse CD14 cell lysate | +Inquiry |
| CD14-1469RCL | Recombinant Rat CD14 cell lysate | +Inquiry |
| CD14-1169CCL | Recombinant Cynomolgus CD14 cell lysate | +Inquiry |
| CD14-1604HCL | Recombinant Human CD14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD14 Products
Required fields are marked with *
My Review for All CD14 Products
Required fields are marked with *
