Recombinant Full Length Human CD1B Protein
Cat.No. : | CD1B-61HF |
Product Overview : | Recombinant full length Human CD1b (amino acids 1-333) with N terminal proprietary tag, 62.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 333 amino acids |
Description : | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. |
Form : | Liquid |
Molecular Mass : | 62.700kDa inclusive of tags |
AA Sequence : | MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNST WAQTQGSGWLDDLQIHGWDSDSGTAIFLKPWSKGNFSDKE VAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC ELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQ KFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQ RQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR GEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLA LWYMRRRSYQNIP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD1B CD1b molecule [ Homo sapiens ] |
Official Symbol | CD1B |
Synonyms | CD1B; CD1b molecule; CD1, CD1b antigen , CD1B antigen, b polypeptide; T-cell surface glycoprotein CD1b |
Gene ID | 910 |
mRNA Refseq | NM_001764 |
Protein Refseq | NP_001755 |
MIM | 188360 |
UniProt ID | P29016 |
◆ Recombinant Proteins | ||
CD1B-61HF | Recombinant Full Length Human CD1B Protein | +Inquiry |
CD1b-0915H | Recombinant Human CD1b Protein (Ser18-Ser303), N-His tagged | +Inquiry |
CD1B-10918H | Recombinant Human CD1B, His-tagged | +Inquiry |
CD1B-3039H | Recombinant Human CD1B Protein, MYC/DDK-tagged | +Inquiry |
CD1B-317R | Recombinant Rhesus CD1B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1B-1504HCL | Recombinant Human CD1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1B Products
Required fields are marked with *
My Review for All CD1B Products
Required fields are marked with *
0
Inquiry Basket