Recombinant Full Length Human CD207 Protein
Cat.No. : | CD207-3015HF |
Product Overview : | Human CD207 full-length ORF (AAH22278.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 377 amino acids |
Description : | The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity. [provided by RefSeq, Aug 2010] |
Form : | Liquid |
Molecular Mass : | 36.7 kDa |
AA Sequence : | MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP |
Applications : | Antibody Production Functional Study Compound Screening |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | CD207 CD207 molecule, langerin [ Homo sapiens ] |
Official Symbol | CD207 |
Synonyms | CD207; CD207 molecule, langerin; CD207 antigen, langerin; C-type lectin domain family 4 member K; CLEC4K; Langerin; Langerhans cell specific c-type lectin; C-type lectin domain family 4, member K; |
Gene ID | 50489 |
mRNA Refseq | NM_015717 |
Protein Refseq | NP_056532 |
MIM | 604862 |
UniProt ID | Q9UJ71 |
◆ Recombinant Proteins | ||
CD207-4789H | Recombinant Human CD207 Protein (Pro65-Pro328), C-His tagged | +Inquiry |
CD207-315H | Recombinant Human CD207 protein, MYC/DDK-tagged | +Inquiry |
CD207-58R | Recombinant Rhesus CD207 protein, Fc-tagged | +Inquiry |
CD207-3051M | Recombinant Mouse CD207 Protein, His-tagged | +Inquiry |
CD207-108H | Recombinant Human CD207 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD207-7680HCL | Recombinant Human CD207 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD207 Products
Required fields are marked with *
My Review for All CD207 Products
Required fields are marked with *
0
Inquiry Basket