Recombinant Full Length Human CD247 Protein, C-Flag-tagged

Cat.No. : CD247-1291HFL
Product Overview : Recombinant Full Length Human CD247 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 16.3 kDa
AA Sequence : MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL
YQGLSTATKDTYDALHMQALPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Protein Pathways : Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway
Full Length : Full L.
Gene Name CD247 CD247 molecule [ Homo sapiens (human) ]
Official Symbol CD247
Synonyms T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3ZETA; CD3-ZETA
Gene ID 919
mRNA Refseq NM_198053.3
Protein Refseq NP_932170.1
MIM 186780
UniProt ID P20963

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD247 Products

Required fields are marked with *

My Review for All CD247 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon